Antibodies

View as table Download

Rabbit Polyclonal Anti-KLF12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF12 antibody: synthetic peptide directed towards the N terminal of human KLF12. Synthetic peptide located within the following region: NIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDM

Rabbit Polyclonal Anti-KLF12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLF12 Antibody: synthetic peptide directed towards the N terminal of human KLF12. Synthetic peptide located within the following region: MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP

Carrier-free (BSA/glycerol-free) KLF12 mouse monoclonal antibody,clone OTI5F9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KLF12 mouse monoclonal antibody,clone OTI3D4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KLF12 mouse monoclonal antibody,clone OTI2A5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF12 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KLF12

KLF12 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KLF12

KLF12 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KLF12.
Modifications Unmodified

KLF12 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human KLF12.

KLF12 mouse monoclonal antibody,clone OTI5F9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF12 mouse monoclonal antibody,clone OTI5F9, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

KLF12 mouse monoclonal antibody,clone OTI5F9, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

KLF12 mouse monoclonal antibody,clone OTI5F9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF12 mouse monoclonal antibody,clone OTI3D4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF12 mouse monoclonal antibody,clone OTI3D4, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

KLF12 mouse monoclonal antibody,clone OTI3D4, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

KLF12 mouse monoclonal antibody,clone OTI3D4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF12 mouse monoclonal antibody,clone OTI2A5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF12 mouse monoclonal antibody,clone OTI2A5, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

KLF12 mouse monoclonal antibody,clone OTI2A5, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

KLF12 mouse monoclonal antibody,clone OTI2A5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated