Rabbit Polyclonal Anti-KLF17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF17 antibody: synthetic peptide directed towards the N terminal of human KLF17. Synthetic peptide located within the following region: YGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSW |
Rabbit Polyclonal Anti-LIN54 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LIN54 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human LIN54. |
KLF17 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-389 of human KLF17 (NP_775755.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
