Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against KLF3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence LMFDPVPVKQEAMD-C, from the N Terminus of the protein sequence according to NP_057615. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Klf3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Klf3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Klf3. Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP |
Rabbit Polyclonal Anti-KLF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF3 antibody: synthetic peptide directed towards the N terminal of human KLF3. Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP |
Rabbit Polyclonal Anti-KLF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLF3 antibody is: synthetic peptide directed towards the C-terminal region of Human KLF3. Synthetic peptide located within the following region: SHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRT |
Klf3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
KLF3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLF3 |
KLF3 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse KLF3 |
KLF3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human KLF3 (NP_057615.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KLF3