Rabbit Polyclonal Anti-KLHL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL1 antibody: synthetic peptide directed towards the middle region of human KLHL1. Synthetic peptide located within the following region: APLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESYDPQTNEWTQMASL |
Rabbit Polyclonal Anti-Klhl1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Klhl1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Klhl1. Synthetic peptide located within the following region: KPSSSSTSSSSSSSASSSPFSPLNGTLLPVATRLQQGAPGQGTQQPARTL |
Rabbit Polyclonal Anti-KLHL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLHL1 |
Klhl1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
KLHL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human KLHL1 |
KLHL1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL1 |
KLHL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human KLHL1 (NP_065917.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
