Antibodies

Jump to Filters
View as table Download
KLHL15 (C-term) Rabbit Polyclonal Antibody
AP23878PU-N

USD 440.00

2 Weeks

KLHL15 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
KLHL15 Rabbit Polyclonal Antibody
TA344319

USD 475.00

5 Days

Rabbit Polyclonal Anti-KLHL15 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL15 antibody: synthetic peptide directed towards the middle region of human KLHL15. Synthetic peptide located within the following region: VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC
KLHL15 Rabbit Polyclonal Antibody
TA306799

USD 430.00

5 Days

Rabbit Polyclonal KLHL15 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLHL15 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human KLHL15.
KLHL15 Rabbit Polyclonal Antibody
TA377852

USD 220.00

3 Weeks

KLHL15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KLHL15 (NP_085127.2).
Modifications Unmodified