Antibodies

Jump to Filters
View as table Download
KLHL7 Rabbit Polyclonal Antibody
TA335511

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLHL7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLHL7 Antibody: synthetic peptide directed towards the middle region of human KLHL7. Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV
KLHL7 Rabbit Polyclonal Antibody
TA377855

USD 220.00

3 Weeks

KLHL7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KLHL7 (NP_061334.4).
Modifications Unmodified