Germany
Japan
United Kingdom
China
Kallikrein 13 (KLK13) (262-277) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide from human KLK13 / Kallikrein 13 (aa 262-277) |
Antibodies
View as table Download
Rabbit Polyclonal Kallikrein-13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Residues 262-277 [IRKYETQQQKWLKGPQ] of the human KLK-L4 protein. |
Rabbit Polyclonal Anti-KLK13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLK13 Antibody: synthetic peptide directed towards the middle region of human KLK13. Synthetic peptide located within the following region: VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN |
Rabbit Polyclonal Anti-KLK13 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLK13 |
KLK13 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLK13 |
KLK13 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLK13 |
KLK13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-277 of human KLK13 (NP_056411.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KLK13