Rabbit polyclonal Kallikrein 6 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Kallikrein 6. |
Rabbit polyclonal Kallikrein 6 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-156 amino acids from the Central region of human Kallikrein 6. |
Rabbit Polyclonal Anti-KLK6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLK6 antibody: synthetic peptide directed towards the N terminal of human KLK6. Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ |
Goat Anti-Klk6 / neurosin (mouse) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Peptide with sequence KEKPGVYTDVCTHIR, from the C-Terminus of the protein sequence according to NP_035307.1. |
KLK6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1). |
| Modifications | Unmodified |
KLK6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
