Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal KPNA2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | KPNA2 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human KPNA2. The immunogen is located within amino acids 40 - 90 of KPNA2. |
KPNA2 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KPNA2 |
Rabbit polyclonal antibody to karyopherin alpha 2 (karyopherin alpha 2 (RAG cohort 1, importin alpha 1))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 468 and 529 of KPNA2 (Uniprot ID#P52292) |
Rabbit Polyclonal Anti-KPNA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KPNA2 antibody: synthetic peptide directed towards the middle region of human KPNA2. Synthetic peptide located within the following region: GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ |
KPNA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KPNA2 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA1 |
KPNA2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KPNA2 |
KPNA2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KPNA2 |
Active filters
Target Symbol
- KPNA2