Antibodies

View as table Download

Goat Polyclonal Antibody against KPNA3 / IPOA4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPTANLQTKEFNF, from the C Terminus of the protein sequence according to NP_002258.

Rabbit Polyclonal KPNA3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KPNA3 antibody was raised against a 14 amino acid synthetic peptide near the carboxy end of human KPNA3.

KPNA3 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal Anti-KPNA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KPNA3 antibody: synthetic peptide directed towards the N terminal of human KPNA3. Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV

KPNA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human KPNA3 (NP_002258.2).

KPNA3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human KPNA3 (NP_002258.2).
Modifications Unmodified