Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 151 results

Page 1 of 4

(reset)

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

TA313117

USD 345.00

4 Weeks

Rabbit polyclonal Keratin 19 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Keratin 19.

1 / 2

2 / 2

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: 4E8]

TA336915

USD 424.00

5 Days

Mouse Monoclonal Cytokeratin 19 Antibody (4E8)

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

TA336915 is a replacement of AM06660SU-N.

Cytokeratin 19 (KRT19) Capture Mouse Monoclonal Antibody [Clone ID: OTI5D1]

TA600498

USD 379.00

In Stock

purified KRT19 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5D1

Applications	ELISA, LMNX
Reactivities	Human
Conjugation	Unconjugated
Matched ELISA Pair	TA700050

1 / 2

2 / 2

Previous Next

Cytokeratin 19 (KRT19) (1-400) Mouse Monoclonal Antibody [Clone ID: AT13D10]

AM50040PU-N

USD 340.00

2 Weeks

Cytokeratin 19 (KRT19) (1-400) mouse monoclonal antibody, clone AT13D10, Purified

Applications	ELISA, FC, IF, WB
Reactivities	Human

Cytokeratin 19 (KRT19) (1-400) Mouse Monoclonal Antibody [Clone ID: AT13D10]

AM50040PU-S

USD 230.00

2 Weeks

Cytokeratin 19 (KRT19) (1-400) mouse monoclonal antibody, clone AT13D10, Purified

Applications	ELISA, FC, IF, WB
Reactivities	Human

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

TA346188

USD 475.00

5 Days

Rabbit Polyclonal Anti-KRT19 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

TA347413

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Keratin 19 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

AP31607PU-N

USD 440.00

2 Weeks

Cytokeratin 19 (KRT19) rabbit polyclonal antibody, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide

1 / 2

2 / 2

Previous Next

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

TA336489

USD 424.00

5 Days

Rabbit Polyclonal Cytokeratin 19 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide derived from the C-terminal region of human Cytokeratin 19 (between residues 350-400) [UniProt P08727]

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

TA336845

USD 424.00

5 Days

Rabbit Polyclonal Cytokeratin 19 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an N-terminal portion of the human Cytokeratin 19 protein (between residues 1-50) [UniProt P08727]

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

TA354724

USD 355.00

5 Days

Rabbit anti Cytokeratin-19 (CK-19) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the N-terminus of human Cytokeratin protein.

1 / 2

2 / 2

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: BA-17]

SM1822B

USD 300.00

2 Weeks

Cytokeratin 19 (KRT19) mouse monoclonal antibody, clone BA-17, Biotin

Applications	WB
Reactivities	Human
Conjugation	Biotin

Cytokeratin 19 (KRT19) Goat Polyclonal Antibody

TA326740

USD 375.00

5 Days

Goat Anti-cytokeratin 19 (aa285-298) Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-HTEQLQMSRSEVTD, from the internal region of the protein sequence according to NP_002267.2.

Cytokeratin 19 (KRT19) Goat Polyclonal Antibody

TA326741

USD 375.00

5 Days

Goat Anti-cytokeratin 19 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-EGQEDHYNNLSASK, from the C Terminus of the protein sequence according to NP_002267.2.

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: BA16]

TA353297L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Keratin19 Clone BA16

Reactivities	Human
Conjugation	Unconjugated

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: BA17]

TA353298L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Keratin19 Clone BA17

Reactivities	Human
Conjugation	Unconjugated

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: LAS86]

TA353299L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Keratin 19 Clone LAS86

Reactivities	Human
Conjugation	Unconjugated

Cytokeratin 19 (KRT19) Capture Mouse Monoclonal Antibody [Clone ID: OTI4E12]

TA600499

USD 379.00

2 Weeks

purified KRT19 Capture mouse monoclonal antibody, Luminex validated, clone OTI4E12

Applications	LMNX
Reactivities	Human
Conjugation	Unconjugated
Matched ELISA Pair	TA700050

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI5D1]

CF500018

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI2F8]

CF500019

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

CF500212

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI4E12]

CF500213

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI4E12 (formerly 4E12)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF500214

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI1F5]

CF803602

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI5B11]

CF803860

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI5B11 (formerly 5B11)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI6A8]

CF803863

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI6A8 (formerly 6A8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI3D10]

CF803964

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI7H7]

CF803966

USD 465.00

4 Weeks

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI7H7 (formerly 7H7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI6E8]

CF803998

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI6E8 (formerly 6E8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

CF803999

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI8A11]

CF804000

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI8H7]

CF804001

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI8H7 (formerly 8H7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI7H1]

CF804003

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI8A1]

CF804008

USD 465.00

4 Weeks

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI9A9]

CF804010

USD 465.00

3 Weeks

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI9A9 (formerly 9A9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI1C11]

CF804073

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI5H6]

CF804075

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI5H6 (formerly 5H6)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI1A8]

CF804133

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI8D1]

CF804618

USD 465.00

4 Weeks

Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI8D1 (formerly 8D1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: A53-B/A2.26]

TA327664

USD 605.00

5 Days

Mouse Monoclonal Cytokeratin 19 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

Cytokeratin 19 (KRT19) Rabbit Monoclonal Antibody [Clone ID: R07-1D4]

TA384629

USD 380.00

4 Weeks

Cytokeratin 19 Rabbit monoclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI5D1]

TA500018

USD 379.00

In Stock

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D1]

TA500018AM

USD 420.00

4 Weeks

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D1]

TA500018BM

USD 420.00

4 Weeks

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI5D1]

TA500018S

USD 159.00

2 Days

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI2F8]

TA500019

USD 379.00

In Stock

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F8]

TA500019AM

USD 420.00

4 Weeks

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F8]

TA500019BM

USD 420.00

4 Weeks

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI2F8]

TA500019S

USD 159.00

2 Days

CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

TA500212

USD 379.00

In Stock

Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 50 of 151 results

Page 1 of 4