Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KRT23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT23 antibody: synthetic peptide directed towards the middle region of human KRT23. Synthetic peptide located within the following region: IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR |
Carrier-free (BSA/glycerol-free) KRT23 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-KRT23 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-250 amino acids of human keratin 23 (histone deacetylase inducible) |
Anti-KRT23 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-250 amino acids of human keratin 23 (histone deacetylase inducible) |
KRT23 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT23 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
KRT23 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
KRT23 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- KRT23