Antibodies

Jump to Filters
View as table Download
KRT26 (397-411) Guinea Pig Polyclonal Antibody
AP09548SU-N

USD 375.00

2 Weeks

KRT26 (397-411) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Human
Immunogen KLH coupled synthetic peptide of Human keratin K26 (formerly also designated keratin K25irs2), aa 397-411
KRT26 (N-term) Rabbit Polyclonal Antibody
AP52414PU-N

USD 450.00

2 Weeks

KRT26 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 116-146 amino acids from the N-terminal region of human KRT26
KRT26 Rabbit Polyclonal Antibody
TA337398

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT26 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT26 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT26. Synthetic peptide located within the following region: IDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDSTEETIVKTVVEEL