Rabbit polyclonal anti-KRT37/38 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KRT37/38. |
Rabbit polyclonal anti-KRT37/38 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KRT37/38. |
Rabbit Polyclonal Anti-KRT38 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KRT38 Antibody is: synthetic peptide directed towards the middle region of Human KRT38. Synthetic peptide located within the following region: DKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILRSQLGE |
Rabbit Polyclonal Anti-KRT38 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KRT38 Antibody is: synthetic peptide directed towards the N-terminal region of Human KRT38. Synthetic peptide located within the following region: AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH |