Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-KRT37/38 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KRT37/38. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KRT38 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KRT38 Antibody is: synthetic peptide directed towards the middle region of Human KRT38. Synthetic peptide located within the following region: DKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILRSQLGE |
Rabbit Polyclonal Anti-KRT38 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KRT38 Antibody is: synthetic peptide directed towards the N-terminal region of Human KRT38. Synthetic peptide located within the following region: AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH |
Active filters
Target Symbol
- KRT38