Antibodies

Jump to Filters
View as table Download
Keratin 39 (KRT39) Guinea Pig Polyclonal Antibody
AP31678SU-N

USD 395.00

2 Weeks

Keratin 39 (KRT39) guinea pig polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide of Human type I (acidic) hair (trichocytic) keratin K39 (former designation keratin Ka35) coupled to KLH
Keratin 39 (KRT39) Rabbit Polyclonal Antibody
TA337399

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT39 antibody is: synthetic peptide directed towards the N-terminal region of Human KRT39. Synthetic peptide located within the following region: NFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAEL