Antibodies

Jump to Filters
View as table Download
Keratin 80 (KRT80) (C-term) Rabbit Polyclonal Antibody
AP52423PU-N

USD 450.00

2 Weeks

Keratin 80 (KRT80) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 417-436 amino acids from the C-terminal region of human KRT80
Keratin 80 (KRT80) Rabbit Polyclonal Antibody
TA331548

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT80 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT80 Antibody is: synthetic peptide directed towards the C-terminal region of Human KRT80. Synthetic peptide located within the following region: VVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEV
Keratin 80 (KRT80) Rabbit Polyclonal Antibody
TA332213

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT80 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT80 Antibody is: synthetic peptide directed towards the N-terminal region of Human KRT80. Synthetic peptide located within the following region: KVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQ