Antibodies

Jump to Filters
View as table Download
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA308219

USD 415.00

5 Days

Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719)
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA338980

USD 375.00

5 Days

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
L Kynurenine Hydrolase (KYNU) (C-term) Rabbit Polyclonal Antibody
AP17533PU-N

USD 450.00

2 Weeks

L Kynurenine Hydrolase (KYNU) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human KYNU
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA338979

USD 310.00

5 Days

Rabbit Polyclonal Anti-KYNU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
CF803959

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI5E4]
CF804063

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA377924

USD 220.00

3 Weeks

KYNU Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of human KYNU (NP_001028170.1).
Modifications Unmodified
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
TA803959

USD 379.00

In Stock

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA803959AM

USD 420.00

4 Weeks

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated

Applications IHC
Reactivities Human, Rat
Conjugation Biotin
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H1]
TA803959BM

USD 420.00

4 Weeks

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated

Applications IHC
Reactivities Human, Rat
Conjugation HRP
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
TA803959S

USD 159.00

2 Days

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI5E4]
TA804063

USD 379.00

In Stock

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E4]
TA804063AM

USD 420.00

4 Weeks

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated

Applications IHC, WB
Reactivities Human, Rat
Conjugation Biotin
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E4]
TA804063BM

USD 420.00

4 Weeks

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated

Applications IHC, WB
Reactivities Human, Rat
Conjugation HRP
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1F1]
TA804120

USD 379.00

In Stock

KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".