Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the N terminal of human KCNH6. Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: PLASPLHPLEVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWG |
KCNH6 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNH6 |
KCNH6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-220 of human KCNH6 (NP_110406.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KCNH6