Antibodies

Jump to Filters
View as table Download
Kcnt1 Mouse Monoclonal Antibody [Clone ID: S3-26]
TA326566

USD 410.00

5 Days

Mouse Monoclonal Anti-Slo2.2 Antibody

Applications WB
Reactivities Human (weak), Mouse, Rat
Conjugation Unconjugated
KCNT1 Rabbit Polyclonal Antibody
TA372848

USD 380.00

4 Weeks

KCNT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNT1
KCNT1 Rabbit Polyclonal Antibody
TA315674

USD 345.00

In Stock

Rabbit polyclonal anti-KCNT1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human KCNT1.
Kcnt1 Rabbit Polyclonal Antibody
TA328977

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KCa4.1 (Slack)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KQEEKQNRRGLAG, corresponding to amino acid residues 619-631 of rat Slack . Intracellular, C-terminal.
Kcnt1 Rabbit Polyclonal Antibody
TA338442

USD 375.00

5 Days

Rabbit Polyclonal Anti-Kcnt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKA