Rabbit Polyclonal Anti-Kctd12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Kctd12 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Kctd12. Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ |
KCTD12 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCTD12 |
KCTD12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 196-325 of human KCTD12 (NP_612453.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China