Rabbit Polyclonal Anti-KHDRBS3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KHDRBS3 antibody: synthetic peptide directed towards the C terminal of human KHDRBS3. Synthetic peptide located within the following region: EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS |
Rabbit Polyclonal Anti-KHDRBS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KHDRBS3 antibody: synthetic peptide directed towards the N terminal of human KHDRBS3. Synthetic peptide located within the following region: MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVI |
KHDRBS3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 177-346 of human KHDRBS3 (NP_006549.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
