Antibodies

Jump to Filters
View as table Download
KIFC2 Rabbit Polyclonal Antibody
TA334705

USD 310.00

5 Days

Rabbit Polyclonal Anti-KIFC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIFC2 antibody: synthetic peptide directed towards the N terminal of human KIFC2. Synthetic peptide located within the following region: VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
KIFC2 Rabbit Polyclonal Antibody
TA334706

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIFC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIFC2 antibody: synthetic peptide directed towards the N terminal of human KIFC2. Synthetic peptide located within the following region: TQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGA