Rabbit Polyclonal Anti-KLC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLC3 antibody: synthetic peptide directed towards the middle region of human KLC3. Synthetic peptide located within the following region: MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL |
Rabbit Polyclonal Anti-KLC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLC3 antibody: synthetic peptide directed towards the middle region of human KLC3. Synthetic peptide located within the following region: LLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNK |
KLC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human KLC3 (NP_803136.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China