Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-KLF15 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-KLF15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF15 antibody: synthetic peptide directed towards the N terminal of human KLF15. Synthetic peptide located within the following region: DASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGS |
Rabbit Polyclonal Anti-KLF15 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Klf15 antibody is: synthetic peptide directed towards the N-terminal region of Klf15. Synthetic peptide located within the following region: MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC |
Rabbit Polyclonal anti-KLF15 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF15 antibody: synthetic peptide directed towards the middle region of human KLF15. Synthetic peptide located within the following region: GPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVP |
KLF15 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLF15 |
KLF15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human KLF15 (NP_054798.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KLF15