Rabbit polyclonal KLF9 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-57 amino acids from the N-terminal region of human KLF9. |
Rabbit Polyclonal Anti-KLF9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF9 antibody: synthetic peptide directed towards the N terminal of human KLF9. Synthetic peptide located within the following region: ARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKE |
Rabbit Polyclonal anti-KLF9 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9. Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE |
Carrier-free (BSA/glycerol-free) KLF9 mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KLF9 mouse monoclonal antibody, clone OTI7H8 (formerly 7H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KLF9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1). |
| Modifications | Unmodified |
KLF9 mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KLF9 mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
KLF9 mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
KLF9 mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KLF9 mouse monoclonal antibody, clone OTI7H8 (formerly 7H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KLF9 mouse monoclonal antibody, clone OTI7H8 (formerly 7H8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
KLF9 mouse monoclonal antibody, clone OTI7H8 (formerly 7H8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
KLF9 mouse monoclonal antibody, clone OTI7H8 (formerly 7H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
