Rabbit Polyclonal Anti-KLHDC8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHDC8B antibody: synthetic peptide directed towards the N terminal of human KLHDC8B. Synthetic peptide located within the following region: MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE |
Rabbit Polyclonal Anti-KLHDC8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHDC8B antibody: synthetic peptide directed towards the middle region of human KLHDC8B. Synthetic peptide located within the following region: AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM |
Goat Anti-KLHDC8B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TKLPRSLRMRDK, from the internal region of the protein sequence according to NP_775817.1. |
Germany
Japan
United Kingdom
China