Rabbit Polyclonal Anti-KLHL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL2 antibody: synthetic peptide directed towards the middle region of human KLHL2. Synthetic peptide located within the following region: TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN |
Carrier-free (BSA/glycerol-free) KLHL2 mouse monoclonal antibody, clone OTI8D8 (formerly 8D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KLHL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLHL2 |
KLHL2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLHL2 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
KLHL2 mouse monoclonal antibody, clone OTI8D8 (formerly 8D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KLHL2 mouse monoclonal antibody, clone OTI8D8 (formerly 8D8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
KLHL2 mouse monoclonal antibody, clone OTI8D8 (formerly 8D8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
KLHL2 mouse monoclonal antibody, clone OTI8D8 (formerly 8D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
