Rabbit Polyclonal Anti-KLHL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL3 antibody: synthetic peptide directed towards the N terminal of human KLHL3. Synthetic peptide located within the following region: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLC |
Rabbit Polyclonal Anti-KLHL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL3 antibody: synthetic peptide directed towards the middle region of human KLHL3. Synthetic peptide located within the following region: LYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL |
Rabbit Polyclonal Anti-KLHL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLHL3 Antibody: synthetic peptide directed towards the N terminal of human KLHL3. Synthetic peptide located within the following region: CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV |
KLHL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLHL3 |
KLHL3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human KLHL3 (NP_059111.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
