Antibodies

Jump to Filters
View as table Download
KREMEN1 Rabbit Polyclonal Antibody
TA320040

USD 430.00

In Stock

Rabbit Polyclonal KREMEN1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal KREMEN1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human KREMEN1.
KREMEN1 Rabbit Polyclonal Antibody
TA335992

USD 375.00

5 Days

Rabbit Polyclonal Anti-KREMEN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KREMEN1 Antibody: synthetic peptide directed towards the N terminal of human KREMEN1. Synthetic peptide located within the following region: LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
KREMEN1 Rabbit Polyclonal Antibody
TA335993

USD 375.00

5 Days

Rabbit Polyclonal Anti-KREMEN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KREMEN1 Antibody: synthetic peptide directed towards the N terminal of human KREMEN1. Synthetic peptide located within the following region: WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR
KREMEN1 Rabbit Polyclonal Antibody
TA377896

USD 220.00

3 Weeks

KREMEN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-380 of human KREMEN1 (NP_001034659.2).
Modifications Unmodified