Antibodies

Jump to Filters
View as table Download
KRT84 Rabbit Polyclonal Antibody
TA333593

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT84 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT84 Antibody: synthetic peptide directed towards the middle region of human KRT84. Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE
KRT84 Mouse Monoclonal Antibody [Clone ID: OTI2D1]
CF811189

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT84 mouse monoclonal antibody,clone OTI2D1

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KRT84 Rabbit Polyclonal Antibody
TA359081

USD 360.00

5 Days

KRT84 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human KRT84
KRT84 Mouse Monoclonal Antibody [Clone ID: OTI2D1]
TA811189

USD 379.00

In Stock

KRT84 mouse monoclonal antibody,clone OTI2D1

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KRT84 Mouse Monoclonal Antibody [Clone ID: OTI2D1]
TA811189S

USD 159.00

2 Days

KRT84 mouse monoclonal antibody,clone OTI2D1

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated