Rabbit Polyclonal Anti-KTN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KTN1 Antibody: synthetic peptide directed towards the middle region of human KTN1. Synthetic peptide located within the following region: EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA |
KTN1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KTN1 |
KTN1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1). |
| Modifications | Unmodified |
KTN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human KTN1 (NP_001072989.1). |
| Modifications | Unmodified |
KTN1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China