Rabbit Polyclonal Anti-LACTB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LACTB2 antibody: synthetic peptide directed towards the middle region of human LACTB2. Synthetic peptide located within the following region: NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE |
Carrier-free (BSA/glycerol-free) LACTB2 mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI3A5 (formerly 3A5)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LACTB2 mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LACTB2 mouse monoclonal antibody, clone OTI4F7 (formerly 4F7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
LACTB2 mouse monoclonal antibody, clone OTI4F7 (formerly 4F7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LACTB2 mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
