Antibodies

Jump to Filters
View as table Download
LANCL2 Rabbit Polyclonal Antibody
TA344841

USD 475.00

5 Days

Rabbit Polyclonal Anti-LANCL2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LANCL2 antibody: synthetic peptide directed towards the middle region of human LANCL2. Synthetic peptide located within the following region: EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK
LANCL2 Rabbit Polyclonal Antibody
TA344842

USD 475.00

5 Days

Rabbit Polyclonal Anti-LANCL2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LANCL2 antibody: synthetic peptide directed towards the middle region of human LANCL2. Synthetic peptide located within the following region: LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV
LANCL2 Rabbit Polyclonal Antibody
TA349167

USD 484.00

5 Days

Rabbit Polyclonal Anti-AJAP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AJAP1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human AJAP1.
LANCL2 Mouse Monoclonal Antibody [Clone ID: OTI2A11]
CF800180

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LANCL2 mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LANCL2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF800249

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LANCL2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LANCL2 Mouse Monoclonal Antibody [Clone ID: OTI2A11]
TA800180

USD 379.00

In Stock

LANCL2 mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LANCL2 Mouse Monoclonal Antibody [Clone ID: OTI2A11]
TA800180S

USD 159.00

2 Days

LANCL2 mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LANCL2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA800249

USD 379.00

In Stock

LANCL2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LANCL2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA800249S

USD 159.00

2 Days

LANCL2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated