Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against LASP1 (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PERRDSQDGSSYR, from the internal region of the protein sequence according to NP_006139.1. |
Antibodies
View as table Download
LASP1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 119-148 amino acids from the Central region of Human LASP1 |
Goat Polyclonal Antibody against LASP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NPNCARCGKIVYP, from the N Terminus of the protein sequence according to NP_006139.1. |
Rabbit Polyclonal Anti-LASP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASP1 antibody: synthetic peptide directed towards the middle region of human LASP1. Synthetic peptide located within the following region: IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ |
Rabbit Polyclonal Anti-LASP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASP1 antibody: synthetic peptide directed towards the C terminal of human LASP1. Synthetic peptide located within the following region: SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN |
LASP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LASP1 |
LASP1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
LASP1 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LASP1