Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV |
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the C terminal of human LBP. Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL |
LBP Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse LBP |
LBP Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein of Human LBP. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
