Antibodies

View as table Download

Rabbit Polyclonal Anti-LBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LBX1 antibody: synthetic peptide directed towards the N terminal of human LBX1. Synthetic peptide located within the following region: DHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG

Rabbit Polyclonal Anti-LBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LBX1 antibody: synthetic peptide directed towards the middle region of human LBX1. Synthetic peptide located within the following region: LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ