Rabbit Polyclonal Anti-LCA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCA5 antibody: synthetic peptide directed towards the N terminal of human LCA5. Synthetic peptide located within the following region: FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST |
Carrier-free (BSA/glycerol-free) LCA5 mouse monoclonal antibody,clone OTI1A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LCA5 mouse monoclonal antibody,clone OTI2D3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LCA5 mouse monoclonal antibody,clone OTI1A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LCA5 mouse monoclonal antibody,clone OTI1A3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LCA5 mouse monoclonal antibody,clone OTI1A3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LCA5 mouse monoclonal antibody,clone OTI1A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LCA5 mouse monoclonal antibody,clone OTI2D3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LCA5 mouse monoclonal antibody,clone OTI2D3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LCA5 mouse monoclonal antibody,clone OTI2D3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LCA5 mouse monoclonal antibody,clone OTI2D3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China