Germany
Japan
United Kingdom
China
Rabbit anti-LCP1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LCP1 |
Antibodies
View as table Download
Goat Anti-LCP1 (aa277-291) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HLENAGCNKIGNFST, from the internal region of the protein sequence according to NP_002289.2. |
Rabbit Polyclonal Anti-LCP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCP1 antibody: synthetic peptide directed towards the N terminal of human LCP1. Synthetic peptide located within the following region: FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK |
Rabbit Polyclonal Anti-LCP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCP1 antibody: synthetic peptide directed towards the C terminal of human LCP1. Synthetic peptide located within the following region: ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDL |
Rabbit anti L-Plastin Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human L-plastin protein. This sequence is identical to rat, mouse and human origins. |
Rabbit Polyclonal Anti-LCP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human LCP1 |
LCP1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LCP1 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSL |
LCP1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human LCP1 |
L-Plastin/LCP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 368-627 of human L-Plastin/LCP1 (NP_002289.2). |
| Modifications | Unmodified |
Plastin L Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Plastin L |
Active filters
Target Symbol
- LCP1