Antibodies

Jump to Filters
View as table Download
LDL Receptor (LDLR) Chicken Polyclonal Antibody
TA306778

USD 430.00

In Stock

Chicken Polyclonal LDL-R Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LDL-R antibody was raised against an 18 amino acid peptide near the center of human LDL-R.
LDL Receptor (LDLR) Rabbit Polyclonal Antibody
TA336722

USD 479.00

2 Weeks

Rabbit Polyclonal LDL R Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human LDL Receptor protein (within residues 500-550). [Swiss-Prot# P01130]
LDL Receptor (LDLR) Rabbit Polyclonal Antibody
TA335244

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-LDLR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA
LDL Receptor (LDLR) (500-550) Rabbit Polyclonal Antibody
RA25068-100

USD 370.00

2 Weeks

LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI4E9]
CF812507

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LDLR mouse monoclonal antibody,clone OTI4E9

Applications WB
Reactivities Human
Conjugation Unconjugated
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
CF812509

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LDLR mouse monoclonal antibody,clone OTI1F4

Applications FC
Reactivities Human
Conjugation Unconjugated
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI7C5]
CF812510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDLR mouse monoclonal antibody,clone OTI7C5

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
LDLR Rabbit Polyclonal Antibody
TA367505

USD 380.00

4 Weeks

LDLR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LDLR
LDL Receptor (LDLR) Rabbit Polyclonal Antibody
TA377985

USD 220.00

3 Weeks

LDL Receptor (LDLR) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human LDL Receptor (LDLR) (NP_000518.1).
Modifications Unmodified
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI4E9]
TA812507

USD 379.00

In Stock

LDLR mouse monoclonal antibody,clone OTI4E9

Applications WB
Reactivities Human
Conjugation Unconjugated
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI4E9]
TA812507S

USD 159.00

2 Days

LDLR mouse monoclonal antibody,clone OTI4E9

Applications WB
Reactivities Human
Conjugation Unconjugated
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
TA812509

USD 379.00

In Stock

LDLR mouse monoclonal antibody,clone OTI1F4

Applications FC
Reactivities Human
Conjugation Unconjugated
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
TA812509S

USD 159.00

2 Days

LDLR mouse monoclonal antibody,clone OTI1F4

Applications FC
Reactivities Human
Conjugation Unconjugated