Antibodies

View as table Download

Rabbit polyclonal anti-LDLRAD1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LDLRAD1.

Rabbit Polyclonal Anti-LDLRAD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDLRAD1 Antibody: synthetic peptide directed towards the middle region of human LDLRAD1. Synthetic peptide located within the following region: DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP