Rabbit polyclonal anti-LDLRAD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LDLRAD1. |
Rabbit polyclonal anti-LDLRAD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LDLRAD1. |
Rabbit Polyclonal Anti-LDLRAD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LDLRAD1 Antibody: synthetic peptide directed towards the middle region of human LDLRAD1. Synthetic peptide located within the following region: DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP |