Rabbit Polyclonal Anti-LGALS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM |
Rabbit polyclonal anti-LGALS1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human LGALS1. |
Galectin 1 (LGALS1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Gst fusion protein from Human Galectin-1 |
Goat Anti-Lgals1 / galectin-1 (aa100-112) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KLPDGHEFKFPNR, from the internal region of the protein sequence according to NP_032521.1. |
Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI1E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-LGALS1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Galectin 1/LGALS1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human Galectin 1/Galectin 1/LGALS1 (NP_002296.1). |
| Modifications | Unmodified |
Galectin 1 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Galectin 1 |
LGALS1 mouse monoclonal antibody,clone OTI1E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS1 mouse monoclonal antibody,clone OTI1E2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS1 mouse monoclonal antibody,clone OTI1E2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LGALS1 mouse monoclonal antibody,clone OTI1E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
