Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Lgals4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS |
GAL4 (LGALS4) mouse monoclonal antibody, clone 1E8, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
LGALS4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human LGALS4 |
Galectin 4/LGALS4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1). |
Active filters
Target Symbol
- LGALS4