Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LGALS8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGALS8 Antibody: synthetic peptide directed towards the C terminal of human LGALS8. Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD |
Anti-LGALS8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 187-317 amino acids of human lectin, galactoside-binding, soluble, 8 |
Galectin 8/LGALS8 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1). |
| Modifications | Unmodified |
Galectin 8/LGALS8 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LGALS8