Antibodies

Jump to Filters
View as table Download
LHFPL4 Rabbit Polyclonal Antibody
TA331520

USD 375.00

5 Days

Rabbit Polyclonal Anti-LHFPL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LHFPL4 Antibody is: synthetic peptide directed towards the C-terminal region of Human LHFPL4. Synthetic peptide located within the following region: LCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILN