Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against LHX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEGHEPHSPSQ, from the C Terminus of the protein sequence according to NP_004780.3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-LHX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LHX2 antibody: synthetic peptide directed towards the middle region of human LHX2. Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA |
Rabbit Polyclonal Anti-Lhx2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Lhx2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lhx2. Synthetic peptide located within the following region: SNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLT |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI3D3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI2H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI5D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI1A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI3E4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI6A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LHX2 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 337-406 of human LHX2 (NP_004780.3). |
| Modifications | Unmodified |
LHX2 mouse monoclonal antibody,clone OTI3D3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI3D3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI3D3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI3D3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI2H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI2H2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI2H2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI2H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI5D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI5D1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI5D1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI5D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI1A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI1A2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI1A2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI1A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI3E4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI3E4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI3E4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI3E4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI6A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI6A6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI6A6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI6A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LHX2 mouse monoclonal antibody,clone OTI4E6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LHX2 mouse monoclonal antibody,clone OTI4E6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LHX2 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- LHX2