Germany
Japan
United Kingdom
China
LHX6 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 36-65 amino acids from the N-terminal region of human Lhx6. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-LHX6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LHX6 antibody: synthetic peptide directed towards the C terminal of human LHX6. Synthetic peptide located within the following region: LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS |
LHX6 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 333-363 amino acids from the C-terminal region of Human LHX6. |
LHX6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 143-392 of human LHX6 (NP_055183.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LHX6