Rabbit Polyclonal Anti-LHX9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LHX9 antibody: synthetic peptide directed towards the C terminal of human LHX9. Synthetic peptide located within the following region: RNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVV |
Rabbit Polyclonal Anti-LHX9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LHX9 antibody: synthetic peptide directed towards the C terminal of human LHX9. Synthetic peptide located within the following region: SFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKF |
Rabbit Polyclonal Anti-Lhx9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lhx9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lhx9. Synthetic peptide located within the following region: QLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQGEQILGHYSQTSRRL |
LHX9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
