Antibodies

Jump to Filters
View as table Download
LIF Rabbit Polyclonal Antibody
TA319675

USD 430.00

5 Days

Rabbit Polyclonal LIF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF.
LIF Rat Monoclonal Antibody [Clone ID: 39N7D10]
TA337172

USD 424.00

5 Days

Rat Monoclonal LIF Antibody (39N7D10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
LIF Rabbit Polyclonal Antibody
TA319047

USD 355.00

3 Weeks

Rabbit polyclonal anti-leukemia inhibitory factor (LIF) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human LIF
Lif Rabbit Polyclonal Antibody
DP3525

USD 385.00

2 Weeks

Lif rabbit polyclonal antibody, Purified

Applications WB
Reactivities Mouse
Immunogen Highly pure recombinant Mouse Leukemia Inhibitory Factor (LIF) (Ser24–Phe203) produced in E. Coli.
Lif Rabbit Polyclonal Antibody
DP3525S

USD 280.00

2 Weeks

Lif rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure recombinant Mouse Leukemia Inhibitory Factor (LIF) (Ser24–Phe203) produced in E. Coli.
LIF Rabbit Polyclonal Antibody
TA335060

USD 375.00

5 Days

Rabbit Polyclonal Anti-LIF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIF antibody: synthetic peptide directed towards the N terminal of human LIF. Synthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ
LIF Rabbit Polyclonal Antibody
TA321468

USD 345.00

4 Weeks

Anti-LIF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor
LIF Rabbit Polyclonal Antibody
TA378033

USD 220.00

3 Weeks

LIF Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-202 of human LIF (NP_002300.1).
Modifications Unmodified
LIF Rabbit Polyclonal Antibody
TA384664

USD 380.00

4 Weeks

LIF Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human LIF. AA range:141-190