Germany
Japan
United Kingdom
China
LIM2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 109-137 amino acids from the C-terminal region of human LIM2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-LIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIM2 antibody: synthetic peptide directed towards the N terminal of human LIM2. Synthetic peptide located within the following region: GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY |
LIM2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human LIM2 (NP_085915.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LIM2