Antibodies

Jump to Filters
View as table Download
LIPI Rabbit Polyclonal Antibody
TA316161

USD 345.00

In Stock

Rabbit polyclonal anti-LIPI antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LIPI.
LIPI Rabbit Polyclonal Antibody
TA338961

USD 375.00

5 Days

Rabbit Polyclonal Anti-LIPI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPI antibody: synthetic peptide directed towards the middle region of human LIPI. Synthetic peptide located within the following region: YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL